PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn108651
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 195aa    MW: 21251.1 Da    PI: 5.8875
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn108651genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.68e-42331331101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i++lq+q+++l+a+la++++
  Achn108651  33 PCAACKILRRRCAEKCVLAPYFPPTDPIKFTTAHRVFGASNIVKFLQELPEYQRADAVSSMVYEAKARLRDPVYGSAGSIFQLQKQVNELQAQLAKAQA 131
                 7************************************************************************************************99 PP

      DUF260 100 el 101
                 +l
  Achn108651 132 QL 133
                 85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.75632133IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4133130IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MESSETTATA TTVSSLSPNS SSSSPPSQVV LSPCAACKIL RRRCAEKCVL APYFPPTDPI  60
KFTTAHRVFG ASNIVKFLQE LPEYQRADAV SSMVYEAKAR LRDPVYGSAG SIFQLQKQVN  120
ELQAQLAKAQ AQLVTMQSQQ ANLVAFICME MAQSPPPQPP SQPSNFDNFN MSSPPYNLFL  180
DETNPGSLWD PLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577197.11e-87PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-76LBD1_ARATH; LOB domain-containing protein 1
TrEMBLV7C0155e-87V7C015_PHAVU; Uncharacterized protein
STRINGGLYMA13G40370.23e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-60LOB domain-containing protein 1